Staff Engineer, Mobile – Tech Lead

United States - Remote·Posted 3mo ago
developer-toolsaiinfrastructuretypescriptreactgraphqlawsgcpllm
<div class="content-intro"><div><strong>About Us:</strong></div> <div>Live experiences help people cross today’s digital divide and focus on what truly connects us – the here, the now, this once-in-a-lifetime moment that’s bringing us together. To fulfill Gametime’s mission of uniting the world through shared experiences, we make it easy for people to discover and access the live experiences that matter most.</div> <div>&nbsp;</div> <div>With platforms on iOS, Android, mobile web and desktop supporting more than&nbsp;60,000&nbsp;events across the US and Canada, we are reimagining the event ticket industry in order to move at the speed of life.</div></div><h2><strong>Job Summary</strong></h2> <h3><strong>Engineering at Gametime</strong></h3> <p>You will be a key contributor to the Engineering team responsible for building and maintaining the client-side applications and backend systems that power the Gametime experience for millions of users. We empower engineers to take full ownership of their code and foster a culture grounded in testing, code reviews, observability, experimentation, and operational excellence. At Gametime, we value collaboration, inclusivity, and the strength of diverse perspectives — creating an environment where people love to build together.</p> <p>We are also investing deeply in the future of AI. This includes building internal tools and workflows powered by AI, incorporating agentic systems into our backend architecture, and preparing our marketplace and infrastructure to be AI-ready. Engineers are encouraged to explore and adopt AI capabilities in their development process, and those who contribute to advancing AI adoption within our stack will play a key role in shaping that evolution.</p> <h3><strong>The Role</strong></h3> <p>We are looking for an experienced Staff Mobile Engineer to join the Gametime Engineering team. This role is responsible for guiding the mobile technology that powers our flagship product — experienced by more than 1 million users every week. This is a senior individual contributor (IC5) position for engineers who are domain experts, lead complex initiatives across teams, and raise the technical bar through mentorship and architectural influence. You will collaborate closely with Engineering, Product, Design, Data, and business stakeholders to shape the future of our platform.</p> <h2><strong>Key Responsibilities</strong></h2> <ul> <li>Define and drive the long-term technical vision and architecture for Gametime's mobile platform across iOS and Android via React Native.</li> <li>Explore, evaluate, and champion AI-powered capabilities within the mobile development workflow — including agentic coding tools, on-device intelligence, and AI-driven personalization features.</li> <li>Own the end-to-end technical strategy for the mobile app, from architecture patterns and platform infrastructure to performance and release engineering.</li> <li>Lead cross-functional initiatives spanning mobile, backend, product, design, and data teams, ensuring alignment on priorities and execution.</li> <li>Establish and enforce engineering standards for code quality, testing, observability, and mobile-specific best practices across the org.</li> <li>Mentor and uplift engineers at all levels through code reviews, architectural guidance, and technical thought leadership.</li> <li>Drive mobile app performance, reliability, and release quality — including CI/CD pipelines, crash monitoring, and progressive rollout strategies.</li> <li>Partner with Product and Design to shape the mobile roadmap, translating business goals into technically sound solutions.</li> <li>Identify and eliminate platform-level bottlenecks that slow down team velocity or degrade user experience.</li> <li>Promote a high-performing, inclusive engineering culture through tech talks, documentation, and engineering excellence.</li> </ul> <h2><strong>Key Competencies</strong></h2> <h3><strong>Technical Skills</strong></h3> <ul> <li><strong>React Native Mastery:</strong> Deep, production-proven expertise in React Native, including the New Architecture (Fabric/TurboModules), bridging native modules, and cross-platform parity strategies.</li> <li><strong>AI Tooling &amp; Integration:</strong> Experienced leveraging AI for code generation and evangelizing best practices for integrating it into the development workflow. Familiar with shipping AI/ML-powered features in mobile apps — on-device models, LLM-backed experiences, and recommendation systems.</li> <li><strong>Mobile Platform Expertise:</strong> Strong understanding of both iOS (Swift/Objective-C) and Android (Kotlin/Java) native layers — comfortable diving into native code when React Native abstractions aren't sufficient.</li> <li><strong>TypeScript:</strong> Expert-level TypeScript usage for type safety, scalability, and maintainable codebases across large mobile teams.</li> <li><strong>State Management &amp; Architecture:</strong> Deep experience with scalable state management patterns (Redux, Zustand, Jotai, or equivalent) and mobile-specific architectural patterns (clean architecture, modular monorepos, etc.).</li> <li><strong>Performance Engineering:</strong> Expert at diagnosing and resolving React Native and native performance bottlenecks — JS thread, UI thread, bridge overhead, memory, startup time, and render optimization.</li> <li><strong>Mobile Observability:</strong> Strong command of mobile crash reporting, performance monitoring, and analytics tooling (e.g., Firebase, Datadog, Sentry, Amplitude).</li> <li><strong>App Distribution &amp; Release Engineering:</strong> Deep knowledge of App Store and Google Play release processes, phased rollouts, feature flags, and OTA update strategies (e.g., EAS Update). Experienced designing mobile CI/CD pipelines using tools like Bitrise, GitHub Actions, and Fastlane.</li> <li><strong>Testing:</strong> Strong culture of testing — unit, integration, and end-to-end testing for mobile using tools like Jest, Detox, or Maestro.</li> <li><strong>Cloud &amp; API Integration:</strong> Proficient with RESTful and GraphQL API design and consumption patterns, and cloud infrastructure as it relates to mobile backends (AWS, GCP, or Azure).</li> </ul> <h3><strong>Leadership &amp; Collaboration</strong></h3> <ul> <li><strong>Technical Vision:</strong> Defines technical direction for the mobile platform with clarity, conviction, and organizational buy-in.</li> <li><strong>Domain Expertise/Ownership:</strong> Deep understanding of the mobile product surface area with the ability to lead initiatives from concept through production at scale.</li> <li><strong>Org-Wide Influence:</strong> Shapes engineering practices, architectural decisions, and tooling choices that extend beyond the mobile team to the broader engineering organization.</li> <li><strong>Mentorship:</strong> Actively mentors engineers and uplifts team performance through coaching, feedback, and hands-on pairing.</li> <li><strong>Project Leadership:</strong> Independently manages the full lifecycle of complex, multi-team projects with competing priorities and stakeholders.</li> <li><strong>Cross-Functional Collaboration:</strong> Trusted partner to Product, Design, Data, and Engineering peers — able to translate technical constraints into business context and vice versa.</li> <li><strong>Strategic Influence:</strong> Helps shape technical direction, roadmap priorities, and engineering best practices at the organizational level.</li> </ul> <h2><strong>Minimum Qualifications</strong></h2> <ul> <li><strong>Education:</strong> Bachelor's degree in Computer Science, Engineering, or a related field (or equivalent practical experience).</li> <li><strong>Experience:</strong> 10+ years in software engineering, with 5+ years of hands-on experience building and scaling production mobile applications, including significant time in React Native.</li> </ul> <p><strong>Nice to Have:</strong></p> <ul> <li>Experience evolving mobile architectures toward a micro frontend model, enabling modular, independently deployable features that scale with growing teams and product complexity</li> </ul> <p class="p1">&nbsp;</p> <p class="p1"><span class="s1"><strong>What We can Offer:</strong></span></p> <ul> <li> <p>Flexible PTO</p> </li> <li> <p>Competitive salary &amp; equity package</p> </li> <li> <p>Monthly Gametime credits for any event ($1,200/yr)</p> </li> <li> <p>Medical, dental, &amp; vision insurance</p> </li> <li> <p>Life insurance and disability benefits</p> </li> <li> <p>Diverse Family-forming benefits through Carrot Fertility</p> </li> <li> <p>401k, HSA, pre-tax savings programs</p> </li> <li> <p>Company off-sites and meet-ups</p> </li> <li> <p>Wellness programs</p> </li> <li> <p>Tenure recognition</p> </li> </ul><div class="content-pay-transparency"><div class="pay-input"><div class="description"><p>At Gametime pay ranges are subject to change and assigned to a job based on specific market median of similar jobs according to 3rd party salary benchmark surveys. Individual pay within that range can vary for several reasons including skills/capabilities, experience, and available budget.</p></div><div class="title">United States - Pay Range</div><div class="pay-range"><span>$213,554</span><span class="divider">&mdash;</span><span>$251,240 USD</span></div></div></div><div class="content-conclusion"><p><strong>Gametime is committed to bringing together individuals from different backgrounds and perspectives. We strive to create an inclusive environment where everyone can thrive, feel a sense of belonging, and do great work together. As an equal opportunity employer, we prohibit any unlawful discrimination against a job applicant on the basis of their race, color, religion, veteran status, sex, parental status, gender identity or expression, transgender status, sexual orientation, national origin, age, disability or genetic information. We respect the laws enforced by the EEOC and are dedicated to going above and beyond in fostering diversity across our company.</strong></p></div>